PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G32800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 168aa    MW: 19133.4 Da    PI: 9.9247
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G32800.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.92.3e-081661144
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     r +W++ Ed+ +  a  + + +   +W+++a+ ++ gRt+ + ++++
  LPERR01G32800.1 16 RRPWSKKEDKVFESALVMCPEHvpdRWALVASQLP-GRTPQEAREHY 61
                     679*****************99*************.******99999 PP

2Myb_DNA-binding25.82.4e-081091451147
                      HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      l++++ +q+G g+W+ I+r    +Rt+ q+ s+ qk+
  LPERR01G32800.1 109 LFLEGLEQYGRGDWRNISRFSVRTRTPTQVASHAQKF 145
                      699********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.9051169IPR017930Myb domain
SMARTSM007172.9E-61567IPR001005SANT/Myb domain
SuperFamilySSF466891.58E-111564IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-81565IPR009057Homeodomain-like
PfamPF002493.5E-71662IPR001005SANT/Myb domain
CDDcd001671.16E-61865No hitNo description
PROSITE profilePS5129410.613100150IPR017930Myb domain
SMARTSM007170.055104148IPR001005SANT/Myb domain
SuperFamilySSF466895.81E-11109150IPR009057Homeodomain-like
CDDcd001677.07E-6109146No hitNo description
TIGRFAMsTIGR015572.8E-10109149IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.0E-5110141IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MDFYGAAAAG REPAARRPWS KKEDKVFESA LVMCPEHVPD RWALVASQLP GRTPQEAREH  60
YEALVADIDL IMRGEVDLPG AWDDDAGNDR RRGTGKPRGE ERRRGTPWLF LEGLEQYGRG  120
DWRNISRFSV RTRTPTQVAS HAQKFFIRQA NNGSRDSKRK SIHDITTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-171780972RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11625RPWSKKEDKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0036112e-89AP003611.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0423B08.
GenBankAP0149572e-89AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622460.17e-82PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-41DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D9V8411e-122A0A0D9V841_9ORYZ; Uncharacterized protein
STRINGORGLA01G0320500.17e-82(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.16e-44MYB family protein